Led Tree Light Lamp Are One Of The Lights That Is Different From The Usage, Purpose, And Application Of Other Normal Lights. It Can Be Used On Many Occasions, For Example, You Are Able To Use Special Lights To Decorate The Stage And Enhance The Illum ...Read More



 SELL PRODUCT
 EXPIRE ON: 24-06-2023



 313

Durkeesox Integrate And Streamline Its Production Procedures In The Factory,leaving The Installation Work That On-site Worker Can Easily Manage Well.That Contributes To Easier Installation,lower Cost And Shorter Construction Time Compared With That O ...Read More



 SELL PRODUCT
 EXPIRE ON: 20-06-2023



 174

With The Rapid Development Of Society, People's Life Is Getting Better And Better. Many Kinds Of Technology Panels Have Been Invented, And The Wood Grain Aluminum Composite Panel Is One Of Them. The Wood Grain Aluminium Composite Panel Is A Kind Of A ...Read More



 SELL PRODUCT
 EXPIRE ON: 20-06-2023



 268

FEEJOY Magnetic Level Gauge Is Usually Used For Medium Level Detection Of Various Towers, Tanks, Spherical Vessels And Boilers. FEEJOY Magnetic Level Gauge Is The Most Advanced, Accurate And Reliable Liquid Level Measurement System. This magnetic Typ ...Read More



 SELL PRODUCT
 EXPIRE ON: 29-03-2023



 276

Features F 800 Mud Pump For Oil Drilling Have Features Of Solid And Compact Structure, Small Volume, Good And Reliable Performance. It Can Meet The Drilling Requirements Such As High Pressure And Big Displacements Whether In Land Drilling Or Off-sho ...Read More



 SELL PRODUCT
 EXPIRE ON: 16-03-2023



 459

ASIC3 Channels, APETx2 Inhibits ASIC3 Channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAT.#: O1040-V CAS N0.: 713544-47-9 Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30 And Cys20-Cy ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 285

X Ray Component Counter, Also Known As SMD Components Counter. The Equipment Adopts The Principle Of Photoelectric Sensing And Uses The Corresponding Relationship Between The Guide Hole Of The Carrier And The Components To Accurately Determine The Nu ...Read More



 SELL PRODUCT
 EXPIRE ON: 24-11-2022



 245

XB8200 Is Mainly Used For Automatic Online Detection Of Positive And Negative Alignment During The Production Of Square Polymer Soft Pack Batteries. The battery X Ray Inspection System Is Based On The Fully Automatic Optical Detection Developed O ...Read More



 SELL PRODUCT
 EXPIRE ON: 06-09-2022



 207

In The Inspection Process Of Electronic Components, The PCB X Ray Inspection Equipment Can Be Directly Connected To The SMT Production Line For High-capacity Automatic Online Full Inspection, It Can Be Used Offline With Unloader And Loader. PCB ...Read More



 SELL PRODUCT
 EXPIRE ON: 30-06-2022



 200

XB8100 SMT AOI Machine Is Mainly Used For Automatic Online Detection Of Positive And Negative Alignment During The Production Of Cylindrical 18650 Batteries. This AOI automated Optical Inspection Equipment Is Based On The Fully Automatic Optical ...Read More



 SELL PRODUCT
 EXPIRE ON: 16-06-2022



 193

XB8100 SMT AOI Machine Is Mainly Used For Automatic Online Detection Of Positive And Negative Alignment During The Production Of Cylindrical 18650 Batteries. This AOI automated Optical Inspection Equipment Is Based On The Fully Automatic Optical ...Read More



 SELL PRODUCT
 EXPIRE ON: 16-06-2022



 115

Fig 1002 Hammer Union Working Pressure: 10,000psi (690 Bar) Through 4-inch Sizes; 7,500 Psi (517bar), 5-and 6-inch Sizes Features: Replaceable,lip-type Seal Provides Primary Seal,protects Secondary Metal-to-metal,and Minimizes Flow Turbulen ...Read More



 BUY PRODUCT
 EXPIRE ON: 18-05-2022



 448

Product Introduction We Provide Wireless Temperature Sensor Only Or Iot Temperature And Humidity Sensor, Which Consists Of The Temperature Probe Or Temperature & Humidity Probe, Data Logger (Wi-Fi/GPRS/LTE) And Antenna Of The Corresponding Frequency ...Read More



 SELL PRODUCT
 EXPIRE ON: 05-05-2022



 319

Laser Cutting Sheet Is Used Successfully In A Wide Variety Of Industries. Cutting Materials With High Power Density Laser Beam. The Thickness Of The Plate Which Can Be Processed In The Range Of Cold Bonding Plate And Hot Bonding Plate Should Be Less ...Read More



 BUY PRODUCT
 EXPIRE ON: 14-04-2022



 350

To Collect And Transport A Range Of Evidence And Samples Or To Secure Any Important Profile, FENGQI Produce Police Security Evidence Bag Widely Used In Law Enforcement Agencies Like Ministry, Police, Customs, And Prison. It Is Also Applicable For Muc ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-01-2022



 245

Aspiring To Be The Best Cable Manufacturer Who Produces Polyvinyl Chloride Insulated Cables In China, Our PVC Insulated 4 Cores Power Cable Or 4 Cores Pvc Insulated Wire Is Normally Used In Power Transmission And Distribution Systems. The 4 Core Pvc ...Read More



 BUY PRODUCT
 EXPIRE ON: 31-01-2022



 267

As One Of The Industrial Wire Manufacturers In China, Our 4mm Orange Circular Cable Is Widely Used In Australia And New Zealand Marktet Following The Standard Of AS/NZS 5000.1. It Is Referred As Orange Circular CU/PVC/PVC 3x4mm²+2.5. We Get The SAA ...Read More



 BUY PRODUCT
 EXPIRE ON: 31-01-2022



 238

FENGQI Specially Designed Document Enclosed Wallet For Europe And Customization Available In Different Sizes And Up To 7 Colors. This Self Adhesive Document Wallets Can Be Easily Stuck To Many Objects In Plastic, Metal, Wood Even Glass. It Is Used I ...Read More



 SELL PRODUCT
 EXPIRE ON: 09-01-2022



 207