Gomez Chemical Is A China Factory that Produce Cellulose HPMC/ HEMC/ HEC and RDP for Many Years. We Provide construction-grade chemical Products, It's A Good Match For Your Business. We Are A Professional Manufacturer Of Cellulose Ether ...Read More



 SELL PRODUCT
 EXPIRE ON: 14-01-2023



 323

Xanthan Gum In Food Applications Do You Know The Uses Of Xanthan Gum In The Food Industry? Food Grade Xanthan Gum, Also Known As E415 Food Additive, Xanthan Gum E 415, Thickener/stabilizer E415, Can Be Used In Milk Drinks, Yogurt, Sausage, Cans, Fro ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 388

Do You Know The Uses Of Xanthan Gum In The Food Industry? Food Grade Xanthan Gum, Also Known As E415 Additive, Xanthan Gum E 415, Thickener/stabilizer E415, Can Be Used In Milk Drinks, Yogurt, Sausage, Cans, Frozen Food, Juices, And Juice-containing ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 374

Click The Links Above To Purchase Xanthan Gum Cosmetics, Xanthan Gum Hand Sanitizer, Etc.! Products Catalog Xanthan Gum Gellan Gum Welan Gum DSTA Gum All Products ? Application Food Applications Health, Personal Care & Cosmetic Applicatio ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 388

Xanthan Gum Pharmaceutical Uses/applications Are As Follows: Pharmaceutical Excipient Xanthan Gum Was Included In The Chinese Pharmacopoeia As A Pharmaceutical Excipient In 2010. Compared With Other Gums And Suspending Agents, Pharmaceutical Gr ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 351

Application Of Zibozan® Xanthan Gum In Drilling, Workover, And Completion Deosen Zibozan® Oil Drilling Grade Xanthan Gum Is An Efficient, High-quality, And Environmentally Friendly Oil Drilling Mud Additive With A Wide Range Of Applications. It ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 365

ASIC3 Channels, APETx2 Inhibits ASIC3 Channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAT.#: O1040-V CAS N0.: 713544-47-9 Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30 And Cys20-Cy ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 248

Peptide Api, Peptide Apis The Biological Activity Of Peptide Is Extensive And Important, And It Can Act On Endocrine System, Digestive System, Cardiovascular System And So On. Although The History Of Peptide As Pharmaceuticals Is Relatively Short, I ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 285

L-type Ca2+ Channels. Calcicludine Is A Potent And Specific Antagonist Of Neuronal L-type CaV Channels1. SPECIFICATION OF CALCICLUDINE Product Name: Calcicludine (Calcicludine, L-type Ca2+ Channel Blocker) CAT.#: C1020-V CAS N0.: 178037-96-2 ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 284

Potent, Specific L-type Ca2+ Channel Blocker (IC50 = 15 NM). Inactive On Other Voltage-dependent Ca2+ Channels. Smooth Muscle Relaxant And Cardiac Contraction Inhibitor. Neurotoxic. Active In Vivo And In Vitro. SPECIFICATION OF CALCISEPTINE Pro ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 301

Classification: Pharmaceutical Intermediates Cas NO.: 168555-66-6 Molecular Formula: C18H19Na2O8P Melting Point: 238-242 °C Boiling Point: 611.8 °C at 760 mmHg Stability: null Refractive index: Flash Point: 611.8 °C at ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 345

Classification: Agrochemicals Cas NO.: 112-89-0 Molecular Formula: C18H37Br Melting Point: 20-23? Boiling Point: 214-216? (12 MmHg) Stability: Stable Under Normal Temperatures And Pressures. Refractive Index:1.462-1.464 Flash Point: 91 C Puri ...Read More



 SELL PRODUCT
 EXPIRE ON: 30-11-2022



 333

Direct Dye Sky Blue 5B Direct Blue 15 For Textile Dye CAS No. 2429-74-5 Other Names DIRECT BLUE 15, DIRECT FAST BLUE 5B MF C34H24N6NA4016S4 EINECS No. 219-385-3 Place Of Origin Hebei, China (Mainland) Type Direct Dye Usage Ink Dyestuffs, Pap ...Read More



 SELL PRODUCT
 EXPIRE ON: 30-11-2022



 540

Anethole Package As Request. We're The Producer And Exporter Of Kinds Aroma Chemicals. It Includes Musk Ambrette, Musk Xylol, Musk Ketone. Besides, We Also Trade Many Others: Ginger Oil Aniseed Oil Cedarwood Oil Benzyl Benzoate Benzyl Aceta ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-10-2022



 379

Eucalyptus Oil Package As Requested. We're The Producer And Exporter Of Kinds Aroma Chemicals. It Includes Musk Ambrette, Musk Xylol, Musk Ketone. Besides, We Also Trade Many Others: Ginger Oil Aniseed Oil Cedarwood Oil Benzyl Benzoate Benz ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-10-2022



 473

Cewarwood Oil Package As Requested. We're The Producer And Exporter Of Kinds Aroma Chemicals. It Includes Musk Ambrette, Musk Xylol, Musk Ketone. Besides, We Also Trade Many Others: Ginger Oil Aniseed Oil Cedarwood Oil Benzyl Benzoate Benzy ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-10-2022



 380

Aniseed Oil Package:50kgs/Drum We're The Producer And Exporter Of Kinds Aroma Chemicals. It Includes Musk Ambrette, Musk Xylol, Musk Ketone. Besides, We Also Trade Many Others: Ginger Oil Aniseed Oil Cedarwood Oil Benzyl Benzoate Benzyl Ace ...Read More



 SELL PRODUCT
 EXPIRE ON: 30-10-2022



 350

RUBBER ACCELERATOR MBT Chemical Name:2-Mercaptobenzothiazole Molecular Formula:C7H5NS2 Molecular Weight: 167.25 CAS NO.: 149-30-4 EINECS NO.: 205-736-8 Specification: Appearance Gray- White Or Light Yellow Powder Initial M.P. OC= 171.0 H ...Read More



 SELL PRODUCT
 EXPIRE ON: 15-09-2022



 630