Hefei KS-V Peptide Biological Technology Co., Ltd. - , China


SPECIFICATION OF CALCISEPTINE APPLICATION OF CALCISEPTINE Calciseptine Is A Natural Peptide Consisting Of 60 Amino Acids With Four Disulfide Bonds. The Peptide Is A Ca2+ Channel Blocker, Has Agonist Actions On L-type Ca2+ Currents Of Frog And Mam ...Read More





 71

Potent, Specific L-type Ca2+ Channel Blocker (IC50 = 15 NM). Inactive On Other Voltage-dependent Ca2+ Channels. Smooth Muscle Relaxant And Cardiac Contraction Inhibitor. Neurotoxic. Active In Vivo And In Vitro. SPECIFICATION OF CALCISEPTINE Pro ...Read More





 146

L-type Ca2+ Channels. Calcicludine Is A Potent And Specific Antagonist Of Neuronal L-type CaV Channels1. SPECIFICATION OF CALCICLUDINE Product Name: Calcicludine (Calcicludine, L-type Ca2+ Channel Blocker) CAT.#: C1020-V CAS N0.: 178037-96-2 ...Read More





 124

Peptide Api, Peptide Apis The Biological Activity Of Peptide Is Extensive And Important, And It Can Act On Endocrine System, Digestive System, Cardiovascular System And So On. Although The History Of Peptide As Pharmaceuticals Is Relatively Short, I ...Read More





 142

ASIC3 Channels, APETx2 Inhibits ASIC3 Channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAT.#: O1040-V CAS N0.: 713544-47-9 Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30 And Cys20-Cy ...Read More





 100